Skip to Content
Merck

AV38212

Anti-SIAH1 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Seven in absentia homolog 1 (Drosophila)

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC, WB
Citations:
1
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

31 kDa

species reactivity

guinea pig, mouse, rat, bovine, rabbit, human, horse, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable, western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SIAH1(6477)

General description

Seven in absentia homolog 1 (Drosophila) (SIAH1) is an E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. SIAH1 has an overlapping function with SIAH2. SIAH1 is involved in the regulation of cellular response to hypoxia and induction of apoptosis. SIAH1 triggers the ubiquitin-mediated degradation of many substrates including the cell surface receptors (DCC, FLT3), the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), and transcription regulators (MγB, POU2AF1, PML and RBBP8). SIAH1 confers constitutive instability to HIPK2 through proteasomal degradation.

Immunogen

Synthetic peptide directed towards the C terminal region of human SIAH1

Application

Anti-SIAH1 (AB2) polyclonal antibody is used to tag seven in absentia homolog 1 (Drosophila) for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of seven in absentia homolog 1 (Drosophila) in many proteosome regulated cellular processes such as response to hypoxia and apoptosis.

Biochem/physiol Actions

Anti-SIAH1 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, zebrafish, chicken, and canine seven in absentia homolog 1 (Drosophila) proteins.
SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson′s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterizedThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson′s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Yan Wang et al.
Neuro-oncology, 24(12), 2107-2120 (2022-06-21)
We previously report that yes-associated protein (YAP), the core downstream effector of Hippo pathway, promotes the malignant progression of glioblastoma (GBM). However, although classical regulatory mechanisms of YAP are well explored, how YAP is modulated by the Hippo-independent manner remains