Skip to Content
Merck

HPA040361

Anti-CX3CL1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Abcd-3, Anti-C3xkine, Anti-Chemokine (c-x3-c motif) ligand 1, Anti-Cxc3, Anti-Cxc3c, Anti-Fractalkine, Anti-Neurotactin, Anti-Ntn, Anti-Scyd1

Sign In to View Organizational & Contract Pricing.

Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
MDL number:
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
6
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:500- 1:1000

immunogen sequence

GVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CX3CL1(6376)

General description

C-X3-C motif chemokine ligand 1(CX3CL1), also known as fractalkine (FKN), is encoded by the gene mapped to human chromosome 16q21. The encoded protein acts as a chemotactic cytokine in a soluble form, or acts as a binding molecule in a membrane-attached form. CX3CL1 is characterized by a mucin-like stalk containing chemokine domain and single transmembrane domain with a short intracellular C-terminal. CX3CL1 belongs to the CX3C chemokine subfamily.

Immunogen

chemokine (C-X3-C motif) ligand 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-CX3CL1 antibody produced in rabbit has been used in tissue microarray (TMA) immunostaining.

Biochem/physiol Actions

CX3CL1 interacts with its cognate receptor CX3CR1 and stimulates chemotaxis of macrophages to apoptotic lymphocytes. The protein also facilitates inflammatory processes in the central nervous system (CNS). CX3CL1 has been implicated in the molecular mechanism that controls cell adhesion, migration and survival of human prostate cancer cells. Hence, the protein has potential therapeutic approach to treatment of prostate cancer. Elevated expression of serum CX3CL1 has been observed in postmenopausal osteoporotic patients. Thus, it acts as a potential diagnostic marker and therapeutic target for anti-resorptive treatment in osteoporosis patients.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Other Notes

Corresponding Antigen APREST81765

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

or

Try our Product Selector Tool to narrow your options


Storage Class

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable



Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library



Lucy A Truman et al.
Blood, 112(13), 5026-5036 (2008-09-19)
Cells undergoing apoptosis are efficiently located and engulfed by phagocytes. The mechanisms by which macrophages, the professional scavenging phagocytes of apoptotic cells, are attracted to sites of apoptosis are poorly defined. Here we show that CX3CL1/fractalkine, a chemokine and intercellular
Yi-Ding Chen et al.
British journal of biomedical science, 73(3), 121-128 (2016-08-02)
The chemokine (C-X3-C motif) ligand 1 (CX3CL1), also called fractalkine (FKN), has recently been reported to be involved in osteoclastogenic process and pathological bone destruction. This study aimed to investigate the link between serum CX3CL1/FKN levels with disease progression of
Gladys Morrison et al.
Stem cell research, 16(1), 140-148 (2016-01-17)
Differentiated cells retain the genetic information of the donor but the extent to which phenotypic differences between donors or batches of differentiated cells are explained by variation introduced during the differentiation process is not fully understood. In this study, we