AV41516
Anti-SLC22A1 (AB1) antibody produced in rabbit
IgG fraction of antiserum
Synonym(s):
Anti-1-Oct, Anti-HOCT1, Anti-Oct1_cds, Anti-Solute carrier family 22 (organic cation transporter), member 1
Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC, WB
Citations:
5
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
61 kDa
species reactivity
bovine, rat, human, horse, guinea pig, rabbit, dog, mouse
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... SLC22A1(6580)
General description
Solute carrier family 22 (organic cation transporter), member 1 (SLC22A1, 1-Oct, HOCT1, Oct1-cds) is a transporter of organic cations (OCT) that in addition to endogenous cations include various external origin cationic toxins and drugs. Examples of drugs transported by OCT1 include metformin, amantadine, pramipexole, and, possibly, levodopa.
Immunogen
Synthetic peptide directed towards the N terminal region of human SLC22A1
Application
Anti-SLC22A1 (AB1) polyclonal antibody is used to tag solute carrier family 22 (organic cation transporter), member 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of solute carrier family 22 (organic cation transporter), member 1 in the transport of small organic cations including a variety of important drugs.
Biochem/physiol Actions
Anti-SLC22A1 (AB1) polyclonal antibody reacts with chicken, pig, bovine, rabbit, human, mouse, rat, and canine solute carrier family 22 (organic cation transporter), member 1 proteins.
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A1 contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Try our Product Selector Tool to narrow your options
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Tianxiang Kevin Han et al.
Molecular pharmacology, 84(2), 182-189 (2013-05-18)
Organic cation transporters (OCTs) are members of the solute carrier 22 family of transporter proteins that are involved in absorption, distribution, and excretion of organic cations. OCT3 is localized in the apical (AP) membrane of enterocytes, but the literature is
Metee Jinakote et al.
Fundamental & clinical pharmacology, 37(4), 833-842 (2023-02-28)
Buspirone, a cationic drug, is an anxiolytic and antidepressant drug. However, whether buspirone and its metabolites are interacted with organic cationic transporter remains uncertain. In this study, we examined the interaction of buspirone and its major metabolites 1-(2-pyrimidinyl)piperazine (1-PP) and
Ruijin Shao et al.
Journal of experimental & clinical cancer research : CR, 33, 41-41 (2014-06-03)
Although a number of in vitro studies have demonstrated the antiproliferative, anti-invasive, and antimetastatic effects of metformin in multiple cancer cell types, its cellular and molecular mechanisms of anti-cancer action in the endometrium of women with polycystic ovary syndrome (PCOS)