Saltar al contenido
Merck

MSQC6

SILuMAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody

recombinant, expressed in CHO cells

Sinónimos:

SILuMAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human, IgG1 kappa, K1 Stable-Isotope Labeled Universal Monoclonal Antibody

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Cambiar Vistas

Acerca de este artículo

NACRES:
NA.12
UNSPSC Code:
12352200
Clone:
-
Species reactivity:
-
Application:
Citations:
5
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle


recombinant

expressed in CHO cells

Quality Level

antibody product type

primary antibodies

assay

≥90% (SDS-PAGE)

packaging

vial of 100 μg (± 10% Lot-specific vial content given on certificate of analysis)

shipped in

wet ice

storage temp.

−20°C

Application

SILu MAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody has been used to spike peptide samples to assess preparation reproducibility.

Features and Benefits

Universal Peptide Sequence Location
FNWYVDGVEVHNAK Heavy Chain (IgG1)
VVSVLTVLHQDWLNGK Heavy Chain (IgG1, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYK Heavy Chain (IgG1, IgG4)
SGTASVVCLLNNFYPR Light Chain (kappa)
VDNALQSGNSQESVTEQDSK Light Chain (kappa)
DSTYSLSSTLTLSK Light Chain (kappa)

SILuMab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.
  • SILuMab yielded reproducible, linear curves from 0.1 μg/mL to 1000 μg/mL without enrichment or depletion.
  • Good agreement was observed between multiple peptides derived from the same target.
  • Label incorporation was determined to be >98% by mass spectrometry.
  • Sequence coverage was confirmed by peptide mapping.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline

Preparation Note

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C<SUB>6</SUB>, 15N<SUB>4</SUB>-labeled Arginine and 13C<SUB>6</SUB>, 15N<SUB>2</SUB>-labeled Lysine.
SILuMab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILuMab provides univer­sal utility, thus eliminating the need for production of candidate-specific internal standards.
SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure
  • Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
  • Add 500 μL of purified water containing 0.1% formic acid to the vial.
  • Mix the contents by gently inverting the vial a minimum of 5 times.
  • Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.

Analysis Note

SILuMAb K1 Heavy Chain

EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKIGTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRWAPLGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMAb K1 Light Chain

QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIYDATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGVVFGGGTKLTVLTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Target overlap areas are underlined
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4
Quantitative
MRM settings provided (xls)

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC


Still not finding the right product?

Pruebe nuestra Herramienta de selección de productos para limitar sus opciones


Clase de almacenamiento

13 - Non Combustible Solids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable



Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos


Contenido relacionado

Instructions


Spille Dorothee et al.
Neurochemical research, 49(5), 1322-1330 (2024-03-13)
Microdialysis is applied in neurointensive care to monitor cerebral glucose metabolism. If recoverable, macromolecules may also serve as biomarkers in brain disease and provide clues to their passage across the blood-brain barrier. Our study aimed to investigate the in vitro
Simone Albrecht et al.
Analytical and bioanalytical chemistry, 410(13), 3197-3207 (2018-04-03)
The monitoring of protein biomarkers for the early prediction of cell stress and death is a valuable tool for process characterization and efficient biomanufacturing control. A representative set of six proteins, namely GPDH, PRDX1, LGALS1, CFL1, TAGLN2 and MDH, which
Bryan E Jones et al.
Science translational medicine, 13(593) (2021-04-07)
Severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2) poses a public health threat for which preventive and therapeutic agents are urgently needed. Neutralizing antibodies are a key class of therapeutics that may bridge widespread vaccination campaigns and offer a treatment solution in