Monoclonal Anti-TRPV1 antibody produced in mouse

The gene encoding transient receptor potential cation channel subfamily V member 1 (TRPV1) is mapped to human chromosome 17p13. It is a non-selective cation channel. The protein is expressed on airway nerve fibers. It is also strongly expressed in sensory neurons.

TRPV1 (NP_542437, 21 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQ

Transient receptor potential cation channel subfamily V member 1 (TRPV1) is a capsaicin receptor. It participates in pain perception. TRPV1 also modulates afferent signals and bronchoconstriction. In the brain, it regulates neuronal function, motor behaviour and neuroinflammation. Capsaicin plays an important role in the activation of TRPV1.

Solution in phosphate buffered saline, pH 7.4

GenBank is a registered trademark of United States Department of Health and Human Services

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.