Sign In to View Organizational & Contract Pricing.
Select a Size
Change View
About This Item
NACRES:
NA.75
UNSPSC Code:
12352200
Form:
liquid
Assay:
≥90% (SDS-PAGE)
Biological source:
human
Recombinant:
expressed in E. coli
biological source
human
recombinant
expressed in E. coli
description
0.05 mg of recombinant human CD164 in 20 mM Tris-HCl buffer, containing NaCl, KCl, EDTA, L-arginine, DTT and glycerol.
sterility
Filtered sterilized solution
assay
≥90% (SDS-PAGE)
form
liquid
packaging
pkg of 50 μg
concentration
0.5 mg protein/mL
accession no.
NP_006007
UniProt accession no.
storage temp.
−20°C
Gene Information
human ... CD164(8763)
Application
Coating a plate well (6 well plate) with this recombinant CD164 matrix protein in HSC cell specific medium at 1-10 μg/well allows for human HSC / receptor interaction studies in vitro.
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained
Use this procedure as a guideline to determine optimal coating conditions for the culture system of choice.
1. Thaw CD164 and dilute to desired concentration using serum-free medium or PBS. The final solution should be sufficiently dilute so the volume added covers the surface evenly (1-10 μg/well, 6 well plate).
Note: Use 1 ml PBS per well in a 6-well plate.
2. Add 1 - 10 μg protein to each well and incubate at 2 to 10 °C overnight.
3. After incubation, aspirate remaining material.
4. Plates are ready for use. They may also be stored at 2-8 °C damp or air dried if sterility is maintained
Preparation Note
The full-length extracellular domain of the human CD164 cDNA (24 - 162 aa) was constructed with 29 N-terminal T7/HIS-tag and expressed in E. coli as inclusion bodies. The final product was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified as soluble protein.
Other Notes
MASMTGGQQMGRGHHHHHHGNLYFQGGEFDKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Storage Class
10 - Combustible liquids
wgk
WGK 2
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Benedikt Demmert et al.
Materials (Basel, Switzerland), 12(11) (2019-06-07)
Calcareous biominerals typically feature a hybrid nanogranular structure consisting of calcium carbonate nanograins coated with organic matrices. This nanogranular organisation has a beneficial effect on the functionality of these bioceramics. In this feasibility study, we successfully employed a flow-chemistry approach
P T Ramos et al.
Materials science & engineering. C, Materials for biological applications, 103, 109742-109742 (2019-07-28)
This study aimed to develop nanocapsules containing ketoprofen using rose hip oil (Keto-NC) as oil core, and to evaluate their anti-inflammatory activity in acute and chronic ear edema models in mice. Physicochemical characterization, drug release, photostability and cytotoxicity assays were
Felipe Díaz-Soler et al.
Nanomaterials (Basel, Switzerland), 11(1) (2021-01-23)
In this work, calcium oxalate (CaOx) precursors were stabilized by poly(acrylic acid) (PAA) as an additive under in vitro crystallization assays involving the formation of pre-nucleation clusters of CaOx via a non-classical crystallization (NCC) pathway. The in vitro crystallization of