Sign In to View Organizational & Contract Pricing.
Select a Size
About This Item
NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC, WB
Citations:
6
biological source
rabbit
conjugate
unconjugated
antibody form
IgG fraction of antiserum
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
36 kDa
species reactivity
human, horse, bovine
concentration
0.5 mg - 1 mg/mL
technique(s)
immunohistochemistry: suitable, western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Quality Level
Gene Information
human ... FOSB(2354)
Looking for similar products? Visit Product Comparison Guide
General description
FOSB is a leucine zipper protein that functions as a transcriptional regulator. Studies in mice have reported that FOSB is involved in cocaine-induced behavioral responses.
Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.
Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.
Immunogen
Synthetic peptide directed towards the C terminal region of human FOSB
Application
Rabbit Anti-FOSB antibody can be used for IHC (4-8μg/ml) and western blot (1.25μg/ml) applications.
Biochem/physiol Actions
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. They are leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: DLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
R F De Pauli et al.
Pharmacology, biochemistry, and behavior, 117, 70-78 (2013-12-21)
Chronic drug exposure and drug withdrawal induce expressive neuronal plasticity which could be considered as both functional and pathological responses. It is well established that neuronal plasticity in the limbic system plays a pivotal role in relapse as well as
N Hiroi et al.
Proceedings of the National Academy of Sciences of the United States of America, 94(19), 10397-10402 (1997-09-18)
Chronic exposure to cocaine leads to prominent, long-lasting changes in behavior that characterize a state of addiction. The striatum, including the nucleus accumbens and caudoputamen, is an important substrate for these actions. We previously have shown that long-lasting Fos-related proteins
Izabelle Dias Benfato et al.
Behavioural brain research, 417, 113630-113630 (2021-10-18)
Social isolation gained discussion momentum due to the COVID-19 pandemic. Whereas many studies address the effects of long-term social isolation in post-weaning and adolescence and for periods ranging from 4 to 12 weeks, little is known about the repercussions of
Josy Carolina C Pontes et al.
Epilepsy research, 126, 16-25 (2016-07-16)
The efficiency of most of the new antiepileptic drugs (AEDs) on clinical trials still falls short the success reported in pre-clinical studies, possibly because the validity of the animal models is insufficient to fully represent the human pathology. To improve
M C Gruda et al.
Oncogene, 12(10), 2177-2185 (1996-05-16)
FosB, one of the members of the Fos family, is rapidly induced in many cell types upon stimulation and has a stimulatory effect on the proliferation of cultured cells. To understand the tissue distribution of FosB, we have studied its
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service