Skip to Content
Merck

WH0055288M1

Monoclonal Anti-RHOT1 antibody produced in mouse

clone 4H4, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-ARHT1, Anti-FLJ11040, Anti-FLJ12633, Anti-MIRO1, Anti-ras homolog gene family, member T1

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
4H4, monoclonal
Application:
ELISA (i), WB
Citations:
19
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

4H4, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

indirect ELISA: suitable, western blot: 1-5 μg/mL

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... RHOT1(55288)

Looking for similar products? Visit Product Comparison Guide

General description

Ras homolog family member T1 (RHOT1) is encoded by the gene mapped to human chromosome 17q11.2. RhoT1 is a member of mitochondrial Rho GTPase family.

Immunogen

RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP

Biochem/physiol Actions

Ras homolog family member T1 (RHOT1) plays an essential role in controlling mitochondrial homeostasis and apoptosis. RHOT1 serves as a tumor suppressor gene for pancreatic cancer (PC), and it can be considered as a potential prognostic biomarker for overall survival and as a promising therapeutic target for PC. Decreased expression of RHOT1 might result in lymph node metastasis (LNM) and shorter survival. RHOT1 has a crucial role to play in mitochondrial transport, lymphocyte migration, and polarity.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

wgk

nwg

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Renu Bajaj et al.
Molecular cytogenetics, 4, 3-3 (2011-01-22)
To evaluate the clinical validity of genome-wide oligonucleotide array comparative genomic hybridization (aCGH) for detecting somatic abnormalities, we have applied this genomic analysis to 30 cases (13 MDS and 17 AML) with clonal chromosomal abnormalities detected in more than 50%
Pei-I Tsai et al.
Molecular biology of the cell, 28(24), 3471-3479 (2017-09-15)
MIC60/mitofilin constitutes a hetero-oligomeric complex on the inner mitochondrial membranes to maintain crista structure. However, little is known about its physiological functions. Here, by characterizing
Hua Jiang et al.
PloS one, 7(7), e42234-e42234 (2012-08-04)
Cancer cell invasion and metastasis are the most important adverse prognostic factors for pancreatic cancer. Identification of biomarkers associated with outcome of pancreatic cancer may provide new approaches and targets for anticancer therapy. The aim of this study is to
Annekathrin Moller et al.
Human molecular genetics, 26(23), 4668-4679 (2017-10-04)
Defective axonal transport is an early neuropathological feature of amyotrophic lateral sclerosis (ALS). We have previously shown that ALS-associated mutations in Cu/Zn superoxide dismutase 1 (SOD1) impair axonal transport of mitochondria in motor neurons isolated from SOD1 G93A transgenic mice
Fei Wang et al.
EMBO reports, 22(7), e52006-e52006 (2021-06-08)
Tunneling nanotubes (TNTs) are actin-rich structures that connect two or more cells and mediate cargo exchange between spatially separated cells. TNTs transport signaling molecules, vesicles, organelles, and even pathogens. However, the molecular mechanisms regulating TNT formation remain unclear and little

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service