Accéder au contenu
Merck

HPA014659

Anti-UAP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-AGX antibody produced in rabbit, Anti-Antigen X antibody produced in rabbit, Anti-Sperm-associated antigen 2 antibody produced in rabbit, Anti-UDP-N-acetylhexosamine pyrophosphorylase antibody produced in rabbit

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

A propos de cet article

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
8
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQ

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UAP1(6675)

General description

UAP1 (UDP-N-acetylglucosamine pyrophosphorylase 1) is a phosphorylase enzyme, which in humans, contains two alternatively spliced isoforms called AGX1 and AGX2. AGX2 has an extra 17-amino acid sequence. UAP1 was first partially purified and characterized from yeast, Neurospora crassa, calf liver and sheep brain. It has three domains, with an SGC superfamily domain in the center. The other two domains are small and make up the N- and C-termini. The center of the core domain contains the nucleotide sugar binding domain. AGX1 is composed of predicted 505 amino acids and AGX2 of 521 amino acids. Their putative molecular weights are ~55.5kDa and ~57.3kDa respectively. This protein is expressed in placenta and testis in the primary spermatocytes.

Immunogen

UDP-N-acetylglucosamine pyrophosphorylase 1

Application

Anti-UAP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

UAP1 (UDP-N-acetylglucosamine pyrophosphorylase 1) catalyzes the formation of UDP-N-acetylglucosamine (UDPGlcNAc) from UTP and GlcNAc1P, in cytoplasm, in the presence of Mg2+/Mn2+. The AGX2 isoform has more affinity for GlcNAc1P than AGX1 isoform. It is a component of the human sperm outer dense fibers (ODFs). It might function in normal sperm motility and related male infertility. This gene is up-regulated in androgen receptor (AR)-positive prostate cancer cell lines

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST70683

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Essayez notre Outil de sélection de produits pour affiner vos choix.


Classe de stockage

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents


Contenu apparenté

Prestige Antibodies Immunofluorescence Procedure


Vinuth N Puttamallesh et al.
Genes, 11(7) (2020-07-12)
Bladder carcinoma (BC) incidence and mortality rates are increasing worldwide. The development of novel therapeutic strategies is required to improve clinical management of this cancer. Aberrant protein expression may lead to cancer initiation and progression. Therefore, the identification of these
Harri M Itkonen et al.
PloS one, 8(5), e65016-e65016 (2013-06-01)
Prostate cancer is the second most common cause of cancer-associated deaths in men and signalling via a transcription factor called androgen receptor (AR) is an important driver of the disease. Androgen treatment is known to affect the expression and activity
A B Diekman et al.
Biology of reproduction, 50(5), 1087-1093 (1994-05-01)
We report the cDNA cloning and subsequent characterization of a novel antigen implicated in antibody-mediated human infertility. This antigen, designated AgX (unknown antigen), was identified originally by screening a human testis lambda gt11 cDNA expression library with infertile patients' sera