Accéder au contenu
Merck

HPA015103

Anti-PTPRZ1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-Protein-tyrosine phosphatase receptor type Z polypeptide 1, Anti-R-PTP-zeta, Anti-Receptor-type tyrosine-protein phosphatase zeta precursor

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

A propos de cet article

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
22
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:500-1:1000

immunogen sequence

LFRHLHTVSQILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLYKTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQGSLFSGPSHIPIPKSSLIT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PTPRZ1(5803)

General description

PTPRZ1 (protein tyrosine phosphatase, receptor-type, Z polypeptide 1) is a transmembrane protein, which belongs to the receptor-type PTP (RPTP) protein subfamily, the members of which resemble cell adhesion molecules. This protein has three isoforms called PTPRZ-A, PTPRZ-B and phosphacan. The N- termini of all the three isoforms contain a carbonic anhydrase-like (CAH) and a fibronectin type III (FNIII) domain. PTPRZ-A and phosphocan contain a spacer having chondroitin sulfate proteoglycan attachment sites, which is absent in PTPRZ-B. This protein is expressed in multiple tumors, and has a normal expression profile in the central nervous system of mammals.
PTPRZ1 is mapped to human chromosome 7q31.32.

Immunogen

Receptor-type tyrosine-protein phosphatase zeta precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-PTPRZ1 antibody produced in rabbit has been used in:
  • immunofluorescence
  • western blotting
  • confocal imaging

Anti-PTPRZ1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

PTPRZ1 (protein tyrosine phosphatase, receptor-type, Z polypeptide 1) plays an essential part in the control of cell growth and motility. This protein, especially its isoform PTPRZ-B, is over-expressed in gliomas, and the different domains of PTPRZ-B, differentially control the proliferation and migration of glioma cells. In renal cell carcinoma (RCC) with von Hippel-Lindau (VHL) inactivation, PTPRZ1 enhances the nuclear expression of β-catenin. This promotes the proliferation of VHL-inactive RCC cells. It is under-expressed in head and neck squamous cell carcinoma (HNSCC), which leads to activation of Met protein. Met protein in turn promotes HNSCC metastasis. It acts as an oncogene in small-cell lung carcinoma, where it controls the phosphorylation of calmodulin, and the progression of tumor. It is also up-regulated in human neuroendocrine tumor (NET) cells, and might have potential as a therapeutic target for the same.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71554

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Essayez notre Outil de sélection de produits pour affiner vos choix.


Classe de stockage

10 - Combustible liquids

wgk

WGK 1

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents



Yaxi Ma et al.
Archives of gynecology and obstetrics, 284(3), 699-704 (2010-10-01)
To investigate PTPRZ1 and CIN85 expression and their significance in cervical carcinoma. The expression of PTPRZ1 and CIN85 was detected by immunohistochemistry and the association between PTPRZ1 and CIN85 expression and clinical pathological variables were analyzed. The expression of PTPRZ1
Norma J Nowak et al.
Cancer genetics and cytogenetics, 161(1), 36-50 (2005-08-06)
Chromosomal instability, manifesting as copy number alterations (CNAs), is characteristic of pancreatic adenocarcinoma. We used bacterial artificial chromosome (BAC) array-based comparative genomic hybridization (aCGH) to examine the pancreatic adenocarcinoma genome for submicroscopic amplifications and deletions. Profiles of 33 samples (17
Kyogo Suzuki et al.
Journal of clinical oncology : official journal of the American Society of Clinical Oncology, 34(28), 3451-3459 (2016-08-11)
Acute lymphoblastic leukemia (ALL) makes up a significant proportion of all pediatric cancers, and relapsed ALL is a leading cause of cancer-associated deaths in children. Identification of risk factors and druggable molecular targets in ALL can lead to a better