Accéder au contenu
Merck

HPA015768

Anti-S100B Antibody

rabbit polyclonal

Synonyme(s) :

Anti-Protein S100-B, Anti-S-100 protein beta chain, Anti-S-100 protein subunit beta, Anti-S100 calcium-binding protein B

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

A propos de cet article

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
27
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider


Nom du produit

Anti-S100B antibody produced in rabbit, affinity isolated antibody, buffered aqueous glycerol solution

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:1000-1:2500

immunogen sequence

LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... S100B(6285)

General description

S100B is a Ca2+ binding protein that is secreted by the astrocytes by an autocrine pathway to activate the release of nitric oxide. S100B may regulate the functions of microglial cells . It may also be associated with the dynamics of intermediary filaments and microtubules in glial cells . Anti-S100B antibodies are specific for S100B in humans. The gene encoding S100B is localized on human chromosome 21.

Immunogen

Protein S100-B recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunocytochemistry (1 paper)
Immunofluorescence (1 paper)
Immunohistochemistry (1 paper)

Biochem/physiol Actions

S-100 β subunit (S100B) exerts paracrine and autocrine effects on neurons and glia. At nanomolar concentrations, the encoded protein promotes neurite outgrowth and increases survival of neurons during development. S100B serves as a marker of melanocyte cytotoxicity. In addition, it also acts as a serum marker in endocrine resistant breast cancer and nonsegmental vitiligo. Decreased expression of S100B has been observed in chronic liver disease patients.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST73328

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Explore all of our products under

ou

Essayez notre Outil de sélection de produits pour affiner vos choix.


Classe de stockage

10 - Combustible liquids

wgk

WGK 1

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents



Lifan Zhu et al.
Molecular medicine reports, 18(6), 4855-4864 (2018-10-04)
The present study aimed to investigate the role of S100B in the inflammation process during osteoarthritis (OA). OA cartilage samples were collected for S100B expression analysis. S100B expression levels were significantly increased in patients with OA compared with the Controls
Rapid detection of trisomy 21
by homologous gene quantitative PCR (HGQ-PCR)
Lee H, et al.
Human Genetics, 99, 364-367 (1997)
Fei Yang et al.
Life (Basel, Switzerland), 11(6) (2021-07-03)
The role of Langerhans cells (LCs) in vitiligo pathogenesis remains unclear, with published studies reporting contradictory results regarding the quantity of LCs and no data on the features of LCs in vitiligo. Here, we aimed to analyze the presence, density