Accéder au contenu
Merck

HPA023310

Anti-BAIAP2 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-BAI-associated protein 2, Anti-BAI1-associated protein 2, Anti-Brain-specific angiogenesis inhibitor 1-associated protein 2, Anti-FLAF3, Anti-IRS-58, Anti-IRSp53, Anti-IRSp53/58, Anti-Insulin receptor substrate p53, Anti-Insulin receptor substrate protein of 53 kDa, Anti-Protein BAP2

Se connecter pour consulter les tarifs organisationnels et contractuels.

Sélectionner une taille de conditionnement

Changer de vue

A propos de cet article

UNSPSC Code:
12352203
NACRES:
NA.43
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
12
Service technique
Besoin d'aide ? Notre équipe de scientifiques expérimentés est là pour vous.
Laissez-nous vous aider


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

rat, human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:50-1:200

immunogen sequence

WFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BAIAP2(10458)

General description

The gene BAIAP2 (BAI1 associated protein 2) is mapped to human chromosome 17q25. The protein has an I-BAR (inverted Bin/amphiphysin/Rvs) domain, a partial Cdc42 (cell division cycle 42)/Rac (v-akt murine thymoma viral oncogene homolog 1) binding domain, Src homology-3 (SH3) domain and a PDZ (PSD95, Dlg1 and zo-1) domain.

Immunogen

Brain-specific angiogenesis inhibitor 1-associated protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-BAIAP2 antibody produced in rabbit has been used in:
  • immunofluorescence (1:50) (1:1,000)
  • immunohistochemistry(1:100)
  • western blotting (1:3500) (1:1,000)
  • iimmunostaining

Biochem/physiol Actions

BAIAP2 (BAI1 associated protein 2) interaction with CDC42 (cell division cycle 42) is needed for filopodia formation. It is also involved in neuronal growth cone guidance. Mutations in BAIAP2 are associated with attention-deficit hyperactivity disorder and autism. BAIAP2 also participates in emotional modulation of memory strength. It also regulates cell motility and mediates the coupling of actin- associated remodeling with Rho guanosine triphosphatase (GTPase) and kinase signaling pathways.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST75831

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Explore all of our products under

ou

Essayez notre Outil de sélection de produits pour affiner vos choix.


Classe de stockage

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable



Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents


Contenu apparenté

Prestige Antibodies Immunofluorescence Procedure


Ai Mei Chou et al.
The Journal of biological chemistry, 289(35), 24383-24396 (2014-07-18)
Filopodia are dynamic actin-based structures that play roles in processes such as cell migration, wound healing, and axonal guidance. Cdc42 induces filopodial formation through IRSp53, an Inverse-Bin-Amphiphysins-Rvs (I-BAR) domain protein. Previous work from a number of laboratories has shown that
Sara Bisi et al.
Nature communications, 11(1), 3516-3516 (2020-07-16)
It is unclear whether the establishment of apical-basal cell polarity during the generation of epithelial lumens requires molecules acting at the plasma membrane/actin interface. Here, we show that the I-BAR-containing IRSp53 protein controls lumen formation and the positioning of the
Lu Liu et al.
Behavioral and brain functions : BBF, 9, 48-48 (2014-01-01)
Attention-deficit/hyperactivity disorder (ADHD) is a common chronic neurodevelopmental disorder with a high heritability. Much evidence of hemisphere asymmetry has been found for ADHD probands from behavioral level, electrophysiological level and brain morphology. One previous research has reported possible association between