05-23-2405 Calcitonin Gene-Related Peptide-II, Human
Recommended Products
Overview
| Replacement Information |
|---|
Key Spec Table
| CAS # | Empirical Formula |
|---|---|
| 98824-26-1 | C₁₆₂H₂₆₇N₅₁O₄₈S₃ |
| Description | |
|---|---|
| Overview | Potent hypotensive agent and vasodilator. |
| Catalogue Number | 05-23-2405 |
| Brand Family | Calbiochem® |
| Synonyms | CGRP-II, βCGRP, ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH₂ |
| References | |
|---|---|
| References | Henke, H., et al. 1987. Brain Res. 410, 404. Finberg, R.W., et al. 1986. FEBS Lett. 209, 97. Finberg, R.W., et al. 1985. FEBS Lett. 183, 403. |
| Applications |
|---|
| Biological Information | |
|---|---|
| Purity | ≥95% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information | |
|---|---|
| R Phrase | R: 20/21/22 Harmful by inhalation, in contact with skin and if swallowed. |
| S Phrase | S: 36 Wear suitable protective clothing. |
| Product Usage Statements |
|---|
| Packaging Information |
|---|
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Catalogue Number | GTIN |
| 05-23-2405 | 0 |
Documentation
Calcitonin Gene-Related Peptide-II, Human Certificates of Analysis
| Title | Lot Number |
|---|---|
| 05-23-2405 |
References
| Reference overview |
|---|
| Henke, H., et al. 1987. Brain Res. 410, 404. Finberg, R.W., et al. 1986. FEBS Lett. 209, 97. Finberg, R.W., et al. 1985. FEBS Lett. 183, 403. |



