Saltar al contenido
Merck

AV42623

Anti-CHAC1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-ChaC, cation transport regulator homolog 1 (E. coli), Anti-MGC4504

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño


Acerca de este artículo

NACRES:
NA.41
UNSPSC Code:
12352203
Conjugate:
unconjugated
Clone:
polyclonal
Application:
WB
Citations:
4
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

24 kDa

species reactivity

pig, rabbit, human, rat, mouse, dog, bovine, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Quality Level

Gene Information

human ... CHAC1(79094)

¿Está buscando productos similares? Visita Guía de comparación de productos

General description

CHAC1/MGC4504 (cation transport regulator-like protein 1), a novel gene regulated by the atherosclerotic lesion component ox-PAPC (oxidized 1-palmitoyl-2-arachidonyl-sn-3-glycero-phosphorylcholine), is a proapoptotic component of the ATF4-ATF3-CHOP cascade mediating the unfolded protein response pathway within cells.

Immunogen

Synthetic peptide directed towards the C terminal region of human CHAC1

Application

Anti-CHAC1 polyclonal antibody is used to tag cation transport regulator-like protein 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CHAC1 in the regulation of apoptosis via the unfolded protein response pathway.

Biochem/physiol Actions

Anti-CHAC1 polyclonal antibody reacts with human, canine, bovine, rat, mouse, mouse, rat, and human cation transport regulator-like protein 1 proteins.
CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Clase de almacenamiento

10 - Combustible liquids

wgk

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Léa Perra et al.
Frontiers in immunology, 9, 2823-2823 (2018-12-18)
In cystic fibrosis (CF), Pseudomonas aeruginosa (Pa) colonizes the lungs, leading to chronic inflammation of the bronchial epithelium. ChaC glutathione-specific γ-glutamylcyclotransferase 1 (CHAC1) mRNA is differentially expressed in primary human airway epithelial cells from bronchi (hAECBs) from patients with CF
Nam E Joo et al.
Cancer medicine, 1(3), 295-305 (2013-01-24)
Nisin, a bacteriocin and commonly used food preservative, may serve as a novel potential therapeutic for treating head and neck squamous cell carcinoma (HNSCC), as it induces preferential apoptosis, cell cycle arrest, and reduces cell proliferation in HNSCC cells, compared
Amandeep Kaur et al.
The Journal of biological chemistry, 292(2), 638-651 (2016-12-04)
Glutathione degradation plays an important role in glutathione and redox homeostasis, and thus it is imperative to understand the enzymes and the mechanisms involved in glutathione degradation in detail. We describe here ChaC2, a member of the ChaC family of
Willian Meira et al.
Cancers, 13(6) (2021-04-04)
In our previous study, we showed that a cystine transporter (xCT) plays a pivotal role in ferroptosis of pancreatic ductal adenocarcinoma (PDAC) cells in vitro. However, in vivo xCTKO cells grew normally indicating that a mechanism exists to drastically suppress

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico