Seleccione un Tamaño
Acerca de este artículo
biological source
equine heart
assay
≥90% (SDS-PAGE)
form
essentially salt-free, lyophilized powder
Iron content
≥0.20%
technique(s)
MALDI-MS: suitable
UniProt accession no.
storage temp.
−20°C
Quality Level
Gene Information
horse ... MB(100054434)
¿Está buscando productos similares? Visita Guía de comparación de productos
Application
- spectral measurements in Beckman DU-50 or Gilford 2400 spectrophotometer
- the secondary structure analysis of proteins in H2O solution using single-pass attenuated total reflection Fourier transform infrared (ATR-FT-IR) microscopy
- the calibration of the mass scale at a concentration of 2 pmol/μL in Electrospray mass spectrometry
- a study to investigate on-line single droplet deposition for MALDI mass spectrometry
- a study to examine protein adsorption in fused-silica and polyacrylamide-coated capillaries
Biochem/physiol Actions
Clase de almacenamiento
11 - Combustible Solids
wgk
WGK 3
flash_point_f
Not applicable
flash_point_c
Not applicable
ppe
Eyeshields, Gloves, type N95 (US)
Elija entre una de las versiones más recientes:
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Which document(s) contains shelf-life or expiration date information for a given product?
If available for a given product, the recommended re-test date or the expiration date can be found on the Certificate of Analysis.
How do I get lot-specific information or a Certificate of Analysis?
The lot specific COA document can be found by entering the lot number above under the "Documents" section.
What is the molecular weight of Product M1882, Myoglobin from equine heart?
Based on the amino acid sequence (16,950) plus the heme group (616), the molecular weight is approximately 17,600 g/mol.
Is Product M1882, Myoglobin from equine heart, oxidized?
Yes, it is oxidized.
Is Product M1882, Myoglobin from equine heart, metmyoglobin?
The M1882 is a mixture, but we have not analyzed the percentages of the oxidized myoglobin or the reduced myoglobin in the product.
Which has more affinity for oxygen, hemoglobin or myoglobin?
The affinity of myoglobin for oxygen is higher than that of hemoglobin.
How do I find price and availability?
There are several ways to find pricing and availability for our products. Once you log onto our website, you will find the price and availability displayed on the product detail page. You can contact any of our Customer Sales and Service offices to receive a quote. USA customers: 1-800-325-3010 or view local office numbers.
What is the Department of Transportation shipping information for this product?
Transportation information can be found in Section 14 of the product's (M)SDS.To access the shipping information for this material, use the link on the product detail page for the product.
Do you have the sequence for Product M1882, Myoglobin from equine heart?
Product M1882 - Myoglobin from equine heart is purified from equine heart. It is not sequenced.Accession P68082 for equine myoglobin has the following sequenceMGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFDKFKHLKTEAEMKASE DLKKHGTVVLTALGGILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHPGDFGADAQGAMTKALELFRNDIAAKYKELGFQGI hope that you find this information helpful.If you have further questions, please reply to this email.Sincerely,Audrey FlemingSigma-Aldrich Technical Service
My question is not addressed here, how can I contact Technical Service for assistance?
Ask a Scientist here.
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico