05-23-2151 Sigma-AldrichPACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem
Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM).
More>> Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM). Less<<Synonyme: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
Empfohlene Produkte
Übersicht
| Replacement Information |
|---|
Key Spec Table
| CAS # | Empirical Formula |
|---|---|
| 127317-03-7 | C₁₄₂H₂₂₄N₄₀O₃₉S |
Preis & Verfügbarkeit
| Bestellnummer | Verfügbarkeit | Verpackung | St./Pkg. | Preis | Menge | |
|---|---|---|---|---|---|---|
| 05-23-2151-0.5MG |
|
Glasflasche | .5 mg |
|
— |
| References | |
|---|---|
| References | Kobayashi, H., et al. 1994. Brain Res. 647, 145. Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027. |
| Product Information | |
|---|---|
| CAS number | 127317-03-7 |
| ATP Competitive | N |
| Form | White to off-white solid |
| Formulation | Supplied as a trifluoroacetate salt. |
| Hill Formula | C₁₄₂H₂₂₄N₄₀O₃₉S |
| Chemical formula | C₁₄₂H₂₂₄N₄₀O₃₉S |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Sold on the basis of peptide content | Y |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | Increases cAMP levels |
| Primary Target IC<sub>50</sub> | EC50 = 4.7 nM increasing cAMP levels in a dose-dependent manner |
| Purity | ≥97% by HPLC |
| Physicochemical Information | |
|---|---|
| Cell permeable | N |
| Peptide Content | Y |
| Peptide Sequence | H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH₂ |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information |
|---|
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Bestellnummer | GTIN |
| 05-23-2151-0.5MG | 04055977226676 |
Documentation
PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem SDB
| Titel |
|---|
PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem Analysenzertifikate
| Titel | Chargennummer |
|---|---|
| 05-23-2151 |
Literatur
| Übersicht |
|---|
| Kobayashi, H., et al. 1994. Brain Res. 647, 145. Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027. |



