05-23-0930 β-Endorphin, Human
More>>
Less<<
β-Endorphin, Human MSDS (material safety data sheet) or SDS, CoA and CoQ, dossiers, brochures and other available documents.
Synonyms: β-Lipoprotein 61-91, Human, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Recommended Products
Overview
Replacement Information |
---|
Key Spec Table
Empirical Formula |
---|
C₁₅₈H₂₅₁N₃₉O₄₆S |
References | |
---|---|
References | Dalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311. Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223. |
Applications |
---|
Biological Information | |
---|---|
Purity | ≥95% by HPLC |
Physicochemical Information | |
---|---|
Peptide Content | Y |
Peptide Sequence | H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS | |
---|---|
RTECS | JZ1650000 |
Safety Information | |
---|---|
R Phrase | R: 20/21/22 Harmful by inhalation, in contact with skin and if swallowed. |
S Phrase | S: 36 Wear suitable protective clothing. |
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Documentation
β-Endorphin, Human Certificates of Analysis
Title | Lot Number |
---|---|
05-23-0930 |
References
Reference overview |
---|
Dalayeun, J.F., et al. 1993. Biomed. Pharmacother. 47, 311. Akil, H., et al. 1984. Annu. Rev. Neurosci. 7, 223. |