481906 Sigma-AldrichAnti-Nicastrin, N-Terminal (62-93) Rabbit pAb
Recommended Products
Overview
| Replacement Information |
|---|
Key Spec Table
| Host |
|---|
| Rb |
| Description | |
|---|---|
| Overview | This product has been discontinued. |
| Catalogue Number | 481906 |
| Brand Family | Calbiochem® |
| Synonyms | Anti-SP716 |
| References | |
|---|---|
| References | Leem, J.Y., et al. 2002. J. Biol. Chem. 277, 19236. Yu, G., et al. 2000. Nature 407, 34. |
| Product Information | |
|---|---|
| Form | Liquid |
| Formulation | Undiluted serum. |
| Preservative | None |
| Biological Information | |
|---|---|
| Immunogen | a synthetic peptide (CQSSISGDTGVIHVVEKEEDLKWVLTDGPNPP) corresponding to amino acids 62-93 of human nicastrin, conjugated to KLH |
| Immunogen | Human |
| Host | Rabbit |
| Isotype | IgG |
| Physicochemical Information |
|---|
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information |
|---|
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Catalogue Number | GTIN |
| 481906 | 0 |
Documentation
Anti-Nicastrin, N-Terminal (62-93) Rabbit pAb Certificates of Analysis
| Title | Lot Number |
|---|---|
| 481906 |
References
| Reference overview |
|---|
| Leem, J.Y., et al. 2002. J. Biol. Chem. 277, 19236. Yu, G., et al. 2000. Nature 407, 34. |


