Millipore Sigma Vibrant Logo

198800 BeKm-1, Mesobuthus eupeus, Recombinant, E. coli

Retrieving price...
Price could not be retrieved
Minimum Quantity is a multiple of
Maximum Quantity is
Upon Order Completion More Information
You Saved ()
Request Pricing
Fulfilment and delivery delayed
Fulfilment and delivery delayed
In Stock 
Limited Quantities Available
Availability to be confirmed
    Remaining : Will advise
      Remaining : Will advise
      Will advise
      Contact Customer Service
      Contact Customer Service


      Contact Customer Service


      Replacement Information

      Key Spec Table

      Empirical Formula

      This product has been discontinued.

      Recombinant, Mesobuthus eupeus BeKm-1 expressed in E. coli. Specifically blocks ERG1 K+ channels (IC50 = 3.3 nM).
      Catalogue Number198800
      Brand Family Calbiochem®
      SynonymsPeptide Inhibitor of M-type K+ Current, RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF
      ReferencesKorolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
      Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.
      Product Information
      ATP CompetitiveN
      Hill FormulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
      Chemical formulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
      Hygroscopic Hygroscopic
      Biological Information
      Primary TargetERG1 K+ channels
      Primary Target IC<sub>50</sub>3.3 nM against ERG1 K+ channels
      Purity≥98% by HPLC
      Physicochemical Information
      Cell permeableN
      Peptide SequenceH-Arg-Pro-Thr-Asp-Ile-Lys-Cys⁷-Ser-Glu-Ser-Tyr-Gln-Cys¹³-Phe-Pro-Val-Cys¹⁷-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys²⁸-Val-Asn-Gly-Phe-Cys³³-Asp-Cys³⁵-Phe-OH Disulfide bonds: Cys⁷ → Cys²⁸; Cys¹³ → Cys³³; Cys¹⁷ → Cys³⁵
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      R PhraseR: 20/21/22

      Harmful by inhalation, in contact with skin and if swallowed.
      S PhraseS: 36

      Wear suitable protective clothing.
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Ambient Temperature Only
      Toxicity Harmful
      Storage -20°C
      Hygroscopic Hygroscopic
      Do not freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Packaging Information
      Transport Information
      Supplemental Information


      BeKm-1, Mesobuthus eupeus, Recombinant, E. coli Certificates of Analysis

      TitleLot Number


      Reference overview
      Korolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
      Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.
      Data Sheet

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision28-April-2008 RFH
      SynonymsPeptide Inhibitor of M-type K+ Current, RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF
      DescriptionRecombinant, Mesobuthus eupeus BeKm-1 expressed in E. coli. Specifically blocks ERG1 K+ channels (IC50 = 3.3 nM). Reported to exhibit properties similar to that of the native toxin.
      Chemical formulaC₁₇₄H₂₆₆N₅₁O₅₁S₆
      Peptide SequenceH-Arg-Pro-Thr-Asp-Ile-Lys-Cys⁷-Ser-Glu-Ser-Tyr-Gln-Cys¹³-Phe-Pro-Val-Cys¹⁷-Lys-Ser-Arg-Phe-Gly-Lys-Thr-Asn-Gly-Arg-Cys²⁸-Val-Asn-Gly-Phe-Cys³³-Asp-Cys³⁵-Phe-OH Disulfide bonds: Cys⁷ → Cys²⁸; Cys¹³ → Cys³³; Cys¹⁷ → Cys³⁵
      Purity≥98% by HPLC
      SolubilityAqueous buffers (4.3 µg/ml)
      Storage -20°C
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing reconstitution aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.
      Toxicity Harmful
      ReferencesKorolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868.
      Filippov, A.K., et al. 1996. FEBS Lett. 384, 277.