198800 Sigma-AldrichBeKm-1, Mesobuthus eupeus, Recombinant, E. coli
Synonyms: RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF, Peptide Inhibitor of M-type K+ Current
Overview
| Replacement Information |
|---|
Key Spec Table
| Empirical Formula |
|---|
| C₁₇₄H₂₆₆N₅₁O₅₁S₆ |
| References | |
|---|---|
| References | Korolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868. Filippov, A.K., et al. 1996. FEBS Lett. 384, 277. |
| Product Information | |
|---|---|
| ATP Competitive | N |
| Form | Lyophilized |
| Hill Formula | C₁₇₄H₂₆₆N₅₁O₅₁S₆ |
| Chemical formula | C₁₇₄H₂₆₆N₅₁O₅₁S₆ |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | ERG1 K+ channels |
| Primary Target IC<sub>50</sub> | 3.3 nM against ERG1 K+ channels |
| Purity | ≥98% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information | |
|---|---|
| R Phrase | R: 20/21/22 Harmful by inhalation, in contact with skin and if swallowed. |
| S Phrase | S: 36 Wear suitable protective clothing. |
| Product Usage Statements |
|---|
| Packaging Information |
|---|
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Catalogue Number | GTIN |
| 198800 | 0 |
Documentation
References
| Reference overview |
|---|
| Korolkova, Y.V., et al. 2001. J. Biol. Chem. 276, 9868. Filippov, A.K., et al. 1996. FEBS Lett. 384, 277. |


