481418 Sigma-AldrichNEMO NOA Peptide, Cell-Permeable, A-UBI - Calbiochem
Recommended Products
Overview
| Replacement Information |
|---|
Key Spec Table
| Empirical Formula |
|---|
| C₂₁₅H₃₄₇N₇₁O₅₀S₁ plus TFA and water |
| References | |
|---|---|
| References | Chiaravalli, J., et al. 2011. Biochem. Pharm. 82, 1163. |
| Product Information | |
|---|---|
| Form | White powder |
| Hill Formula | C₂₁₅H₃₄₇N₇₁O₅₀S₁ plus TFA and water |
| Chemical formula | C₂₁₅H₃₄₇N₇₁O₅₀S₁ plus TFA and water |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Purity | ≥95% by HPLC |
| Physicochemical Information | |
|---|---|
| Peptide Sequence | RQIKIWFQNRRMKWKKLKAQADIYKARFQAERHAREK |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Catalogue Number | GTIN |
| 481418 | 0 |
Documentation
NEMO NOA Peptide, Cell-Permeable, A-UBI - Calbiochem SDS
| Title |
|---|
NEMO NOA Peptide, Cell-Permeable, A-UBI - Calbiochem Certificates of Analysis
| Title | Lot Number |
|---|---|
| 481418 |
References
| Reference overview |
|---|
| Chiaravalli, J., et al. 2011. Biochem. Pharm. 82, 1163. |



