Iniciar sesión para ver los precios por organización y contrato.
Seleccione un Tamaño
Cambiar Vistas
Acerca de este artículo
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IF, IHC
Citations:
42
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarlebiological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunofluorescence: 0.25-2 μg/mL, immunohistochemistry: 1:200-1:500
immunogen sequence
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ATF3(467)
General description
Activating transcription factor 3 (ATF3) gene is mapped to human chromosome 1q32.3. The encoded protein belongs to the cAMP-response element binding (CREB) protein family.
Rabbit polyclonal anti-ATF3 antibody reacts with human activating transcription factor 3.
Immunogen
Cyclic AMP-dependent transcription factor ATF-3 recombinant protein epitope signature tag (PrEST)
Application
Anti-ATF3 antibody produced in rabbit has been used in:
- western blotting
- immunofluorescence
- immunohistochemical staining
- chromatin immunoprecipitation (ChIP)
Biochem/physiol Actions
Activating transcription factor 3 (ATF3), a cyclic AMP-dependent transcription factor stimulates transcription by sequestering inhibitory cofactors. ATF3 responds to stress signals and is involved in the regulation of immune and metabolic homeostasis. It helps to prevent chronic inflammation and starvation responses. ATF3 expression is induced in response to eye injury. It serves as a marker for neuronal injury.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST77475
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Still not finding the right product?
Clase de almacenamiento
10 - Combustible liquids
wgk
WGK 1
ppe
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Elija entre una de las versiones más recientes:
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Contenido relacionado
Prestige Antibodies Immunofluorescence Procedure
Saisai Wei et al.
The Journal of biological chemistry, 289(13), 8947-8959 (2014-02-21)
Mutant p53 proteins (mutp53) often acquire oncogenic activities, conferring drug resistance and/or promoting cancer cell migration and invasion. Although it has been well established that such a gain of function is mainly achieved through interaction with transcriptional regulators, thereby modulating
Activating transcription factor 3 (ATF3) expression in the neural retina and optic nerve of zebrafish during optic nerve regeneration
Saul KE, et al.
Comparative Biochemistry and Physiology. Part A, Molecular & Integrative Physiology, 155(2), 172-182 (2010)
Makoto Edagawa et al.
The Journal of biological chemistry, 289(31), 21544-21561 (2014-06-19)
Death receptor 5 (DR5) is a death domain-containing transmembrane receptor that triggers cell death upon binding to its ligand, TNF-related apoptosis-inducing ligand (TRAIL), and a combination of TRAIL and agents that increase the expression of DR5 is expected to be