Saltar al contenido
Merck

HPA009682

Anti-NDFIP1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Breast cancer-associated protein SGA-1M antibody produced in rabbit, Anti-NEDD4 WW domain-binding protein 5 antibody produced in rabbit, Anti-NEDD4 family-interacting protein 1 antibody produced in rabbit, Anti-Putative MAPK-activating protein PM13 antibody produced in rabbit, Anti-Putative NF-κ-B-activating protein 164 antibody produced in rabbit, Anti-Putative NFKB and MAPK-activating protein antibody produced in rabbit

Iniciar sesión para ver los precios por organización y contrato.

Seleccione un Tamaño

Cambiar Vistas

Acerca de este artículo

UNSPSC Code:
12352203
NACRES:
NA.41
Human Protein Atlas Number:
Conjugate:
unconjugated
Clone:
polyclonal
Application:
IHC
Citations:
11
Servicio técnico
¿Necesita ayuda? Nuestro equipo de científicos experimentados está aquí para ayudarle.
Permítanos ayudarle


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:20-1:50

immunogen sequence

SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... NDFIP1(80762)

General description

NDFIP1 (Nedd4 family interacting protein 1) is an adaptor protein belonging to the Nedd4 (neural precursor cell expressed developmentally down-regulated protein 4) protein family. It was originally identified in a Nedd4-binding protein screen. It resides in the Golgi and post-Golgi vesicles, and is composed of three transmembrane domains.

Immunogen

NEDD4 family-interacting protein 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

NDFIP1 (Nedd4 family interacting protein 1) binds with membrane proteins and controls their interaction with cytoplasmic protein Nedd4 (neural precursor cell expressed developmentally down-regulated protein 4). In brain, it is co-expressed with Nedd4 in neurons, and during neuronal injury, their interaction is critical for promoting the survival of cortical neurons. It is neuroprotective, and in collaboration with Nedd4, ubiquitinates and removes harmful proteins, post brain-injury. It maintains iron homeostasis in cells by interacting with divalent metal transporter 1 (DMT1) and promoting its degradation. In brains of Parkinson′s disease (PD) patients, this protein is found to be expressed in astrocytes, where it is normally absent. Elevation in Parkinsonian brain iron levels leads to the up-regulation of NDFIP1 protein for the control of DMT1.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Other Notes

Corresponding Antigen APREST71932

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.


Still not finding the right product?

Explore all of our products under

o

Pruebe nuestra Herramienta de selección de productos para limitar sus opciones


Clase de almacenamiento

10 - Combustible liquids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)



Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos



Ulrich Putz et al.
The Journal of biological chemistry, 283(47), 32621-32627 (2008-09-30)
The ability to remove unwanted proteins is an important cellular feature. Classically, this involves the enzymatic addition of ubiquitin moieties followed by degradation in the proteasome. Nedd4 proteins are ubiquitin ligases important not only for protein degradation, but also for
Johannes Routila et al.
BMC cancer, 21(1), 868-868 (2021-07-30)
Currently, no clinically useful biomarkers for radioresistance are available in head and neck squamous cell carcinoma (HNSCC). This study assesses the usefulness of Cell Line Microarray (CMA) method to enhance immunohistochemical screening of potential immunohistochemical biomarkers for radioresistance in HNSCC
Jason Howitt et al.
Proceedings of the National Academy of Sciences of the United States of America, 106(36), 15489-15494 (2009-08-27)
The regulation of metal ion transport within neurons is critical for normal brain function. Of particular importance is the regulation of redox metals such as iron (Fe), where excess levels can contribute to oxidative stress and protein aggregation, leading to