Millipore Sigma Vibrant Logo

374087 Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1)

Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.

Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) : FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.

Synonymes: Anti-HO-1, Anti-Hsp32

View Products on Sigmaaldrich.com
374087
Voir les Prix & la Disponibilité

Aperçu

Replacement Information

Tableau de caractéristiques principal

Species ReactivityHostAntibody Type
B, Ca, H, Mk, M, RMMonoclonal Antibody

Prix & Disponibilité

Référence DisponibilitéConditionnement Qté Prix Quantité
374087-200UG
Récupération des données relatives à la disponibilité...
—
Disponibilité limitée Disponibilité limitée
En stock 
Interrompu(e)
Disponible en quantités limitées
Disponibilité à confirmer
    Pour le restant : Nous vous tiendrons informé
      Pour le restant : Nous vous tiendrons informé
      Nous vous tiendrons informé
      Contacter le Service Clients
      Contact Customer Service

      		 Ampoule plast. 200 μg
      Prix en cours de récupération
      Le prix n'a pas pu être récupéré
      La quantité minimale doit être un multiple de
      Maximum Quantity is
      À la validation de la commande Plus d'informations
      Vous avez sauvegardé ()
       
      —
      Demander le prix
      		 —
      Description
      OverviewRecognizes the ~32 kDa HO-1 protein.
      Catalogue Number374087
      Brand Family Calbiochem®
      SynonymsAnti-HO-1, Anti-Hsp32
      Application Data
      Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

      Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
      References
      ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
      Maines, M.D. 1988. FASEB J. 2, 2557.
      Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
      Product Information
      FormLiquid
      FormulationIn PBS, 50% glycerol.
      Preservative≤0.1% sodium azide
      Quality LevelMQ100
      Applications
      Key Applications Immunoblotting (Western Blotting)
      Immunocytochemistry
      Immunoprecipitation
      Application NotesImmunoblotting (4 µg/ml, chemiluminescence)
      Immunocytochemistry (1:1000)
      Immunoprecipitation (20 µg/ml)
      Application CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
      Biological Information
      Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
      ImmunogenHuman
      CloneHO-1-1
      HostMouse
      IsotypeIgG₁
      Species Reactivity
      • Bovine
      • Canine
      • Human
      • Monkey
      • Mouse
      • Rat
      Antibody TypeMonoclonal Antibody
      Concentration Label Please refer to vial label for lot-specific concentration
      Physicochemical Information
      Dimensions
      Materials Information
      Toxicological Information
      Safety Information according to GHS
      Safety Information
      Product Usage Statements
      Storage and Shipping Information
      Ship Code Blue Ice Only
      Toxicity Standard Handling
      Storage -20°C
      Avoid freeze/thaw Avoid freeze/thaw
      Do not freeze Ok to freeze
      Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
      Packaging Information
      Transport Information
      Supplemental Information
      Specifications
      Global Trade Item Number
      Référence GTIN
      374087-200UG 04055977191165

      Documentation

      Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) FDS

      Titre

      Fiche de données de sécurité des matériaux (FDS) 

      Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) Certificats d'analyse

      TitreNuméro de lot
      374087

      Références bibliographiques

      Aperçu de la référence bibliographique
      Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
      Maines, M.D. 1988. FASEB J. 2, 2557.
      Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.
      Fiche technique

      Note that this data sheet is not lot-specific and is representative of the current specifications for this product. Please consult the vial label and the certificate of analysis for information on specific lots. Also note that shipping conditions may differ from storage conditions.

      Revision11-November-2011 JSW
      SynonymsAnti-HO-1, Anti-Hsp32
      ApplicationImmunoblotting (4 µg/ml, chemiluminescence)
      Immunocytochemistry (1:1000)
      Immunoprecipitation (20 µg/ml)
      Application Data
      Detection of human heme oxygenase-1 by immunoblotting. Sample: Extract from human microsomes. Primary antibody: Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (Cat. No. 374087) (1:250). Detection: chemiluminescence.

      Detection of human heme oxygenase-1 by flow cytometry. Sample: Human lung cancer A2 cells (both panels). Primary antibodies: Isotope control (left panel) and Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) (right panel) (Cat. No. 374087) (10 µg/ml). Detection: fluorescence.
      DescriptionProtein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
      BackgroundHeme oxygenase (HO) is a microsomal enzyme that oxidatively cleaves heme, a pro-oxidant, into carbon monoxide and biliverdin, which is reduced to the antioxidant, bilirubin. Two isozymes, termed HO-1 and HO-2, have been identified in rat, rabbit, monkey, and human tissues. By SDS-PAGE, mammalian HO-1 is ~31-33 kDa; HO-2 is ~36 kDa. HO-1, also referred to as stress protein Hsp32, is the inducible form of the enzyme. Expression of HO-1 can be induced by a variety of stimuli such as heme, metals, hormones, UV radiation and sulfhydryl depleting agents. In contrast, HO-2 is the constitutive form of the enzyme. HO-2 is the most prevalent form in most tissues, except the spleen where HO-1 levels are predominant.
      HostMouse
      Immunogen speciesHuman
      Immunogena synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
      CloneHO-1-1
      IsotypeIgG₁
      Speciesbovine, canine, human, monkey, mouse, rat
      FormLiquid
      FormulationIn PBS, 50% glycerol.
      Concentration Label Please refer to vial label for lot-specific concentration
      Preservative≤0.1% sodium azide
      CommentsDoes not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
      Storage Avoid freeze/thaw
      -20°C
      Do Not Freeze Ok to freeze
      Special InstructionsFollowing initial thaw, aliquot and freeze (-20°C).
      Toxicity Standard Handling
      ReferencesYoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
      Maines, M.D. 1988. FASEB J. 2, 2557.
      Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131.