05-23-2005 Sigma-AldrichNeuropeptide Y, Human - CAS 90880-35-6 - Calbiochem
A potent vasoconstrictor.
More>> A potent vasoconstrictor. Less<<FDS (Fiches de données de sécurité), certificats d’analyse (CoA) et de qualité (CoQ), dossiers, brochures et autres documents disponibles.
Synonymes: NPY, Human, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH₂
Produits recommandés
Aperçu
Replacement Information |
---|
Tableau de caractéristiques principal
Empirical Formula | CAS # |
---|---|
C₁₈₉H₂₈₅N₅₅O₅₇S | 90880-35-6 |
Prix & Disponibilité
Référence | Disponibilité | Conditionnement | Qté | Prix | Quantité | |
---|---|---|---|---|---|---|
05-23-2005-0.5MG |
|
Flacon en verre | .5 mg |
|
— | |
05-23-2005-1MG |
|
Ampoule plast. | 1 mg |
|
— |
References | |
---|---|
References | Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280. Wahlestedt, C., et al. 1993. Science 259, 528. Leibowitz, S.F. 1992. NeuroReport 3, 1023. |
Product Information | |
---|---|
CAS number | 90880-35-6 |
ATP Competitive | N |
Form | White to off-white lyophilized solid |
Formulation | Supplied as trifluoroacetate salt. Sold on the basis of peptide content. |
Hill Formula | C₁₈₉H₂₈₅N₅₅O₅₇S |
Chemical formula | C₁₈₉H₂₈₅N₅₅O₅₇S |
Reversible | Y |
Sold on the basis of peptide content | Y |
Quality Level | MQ100 |
Applications |
---|
Biological Information | |
---|---|
Primary Target | A potent vasoconstrictor |
Purity | ≥97% by HPLC |
Dimensions |
---|
Materials Information |
---|
Toxicological Information |
---|
Safety Information according to GHS |
---|
Safety Information | |
---|---|
R Phrase | R: 20/21/22 Harmful by inhalation, in contact with skin and if swallowed. |
S Phrase | S: 36 Wear suitable protective clothing. |
Product Usage Statements |
---|
Packaging Information |
---|
Transport Information |
---|
Supplemental Information |
---|
Specifications |
---|
Documentation
Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem FDS
Titre |
---|
Neuropeptide Y, Human - CAS 90880-35-6 - Calbiochem Certificats d'analyse
Titre | Numéro de lot |
---|---|
05-23-2005 |
Références bibliographiques
Aperçu de la référence bibliographique |
---|
Xiong, Z., and Cheung, D.W. 1994. Pflugers Arch. 429, 280. Wahlestedt, C., et al. 1993. Science 259, 528. Leibowitz, S.F. 1992. NeuroReport 3, 1023. |