196350 Sigma-AldrichBak BH3 Fusion Peptide, Cell-Permeable
A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function.
More>> A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Less<<Sinónimos: RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY, Ant-BH3
Productos recomendados
Descripción
| Replacement Information |
|---|
Tabla espec. clave
| Empirical Formula |
|---|
| C₁₉₆H₃₂₁N₆₅O₄₇S₂ |
| References | |
|---|---|
| References | Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298. Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913. |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | Bcl-xL |
| Purity | ≥95% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Número de referencia | GTIN |
| 196350 | 0 |
Documentation
Bak BH3 Fusion Peptide, Cell-Permeable Certificados de análisis
| Cargo | Número de lote |
|---|---|
| 196350 |
Referencias bibliográficas
| Visión general referencias |
|---|
| Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298. Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913. |
Folleto
| Cargo |
|---|
| Caspases and other Apoptosis Related Tools Brochure |


