532385 Sigma-AldrichCaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem
Produits recommandés
Aperçu
| Replacement Information |
|---|
Prix & Disponibilité
| Référence | Disponibilité | Conditionnement | Qté | Prix | Quantité | |
|---|---|---|---|---|---|---|
| 5.32385.0001 |
|
Flacon en verre | 1 set |
|
— |
| Product Information | |
|---|---|
| Form | Solid |
| Formulation | Supplied as a set of 2 mg TATCN21 (positive control, 5.32441.0001) and 2 mg TATCtrl (negative control, 5.32442.0001). Supplied as a trifluroacetate salt. |
| Hygroscopic | Hygroscopic |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | CaMKII |
| Primary Target IC<sub>50</sub> | ~5 µ |
| Purity | ≥95% by HPLC |
| Physicochemical Information | |
|---|---|
| Peptide Sequence | TATCN21: YGRKKRRQRRRKRPPKLGQIGRSKRVVIEDDR
TATCtrl: YGRKKRRQRRRVKEPRIDGKPVRLRGQKSDRI |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Référence | GTIN |
| 5.32385.0001 | 04055977287233 |
Documentation
CaM Kinase II Inhibitor, TATCN21 and Negative Control Set - Calbiochem FDS
| Titre |
|---|
Références bibliographiques
| Aperçu de la référence bibliographique |
|---|
| Liu, X., et al. 2014. Neuropsychopharm. 29, 989. Tao-Chemg, J. H., et al. 2013. Neurosci. 244, 188. Ashpole, N.M., et al. 2013. J. Biol. Chem. 288, 14599. Vest, R. S., et al. 2007. Mol. Bio. of Cell. 18, 5024. |
Informations techniques
| Titre |
|---|
| White Paper: Further considerations of antibody validation and usage. |


