219482 Sigma-AldrichCaveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo.
More>> Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. Less<<Synonymes: AP-Cav, Pen-C1-SD, RQIKIWFQNRRMKWKK-DGIWKASFTTFTVTKYWFYR, Cavtratin
Produits recommandés
Aperçu
| Replacement Information |
|---|
Tableau de caractéristiques principal
| Empirical Formula |
|---|
| C₂₂₈H₃₃₅N₆₁O₄₉S |
Prix & Disponibilité
| Référence | Disponibilité | Conditionnement | Qté | Prix | Quantité | |
|---|---|---|---|---|---|---|
| 219482-1MG |
|
Ampoule plast. | 1 mg |
|
— |
| Product Information | |
|---|---|
| ATP Competitive | N |
| Form | White lyophilized solid |
| Formulation | Supplied as a trifluoroacetate salt. |
| Hill Formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| Chemical formula | C₂₂₈H₃₃₅N₆₁O₄₉S |
| HS Code | 2933 99 99 |
| Hygroscopic | Hygroscopic |
| Reversible | N |
| Quality Level | MQ100 |
| Applications | |
|---|---|
| Application | Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, blocks eNOS activity and cellular NO release in vitro and reduces inflammation and tumorigenesis in vivo. |
| Biological Information | |
|---|---|
| Primary Target | eNOS |
| Purity | ≥95% by HPLC |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Référence | GTIN |
| 219482-1MG | 04055977218565 |
Documentation
Required Licenses
| Title |
|---|
| PRODUCTO REGULADO POR LA SECRETARÍA DE SALUD |
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem FDS
| Titre |
|---|
Caveolin-1 Scaffolding Domain Peptide, Cell-permeable - Calbiochem Certificats d'analyse
| Titre | Numéro de lot |
|---|---|
| 219482 |
Références bibliographiques
| Aperçu de la référence bibliographique |
|---|
| Bernatchez, P.N., et al. 2005. Proc. Natl. Acad. Sci. USA 102, 761. Williams, T.M., et al. 2004. J. Biol. Chem. 279, 51630. Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Liu, J., et al. 2002. J. Biol. Chem. 277, 10661. Bucci, M., et al. 2000. Nat. Med. 6, 1362. Okamoto, T., et al. 1998. J. Biol. Chem. 273, 5419. |



