508761 Sigma-AldrichPCSK9 Inhibitor, EGF-A - Calbiochem
Aperçu
| Replacement Information |
|---|
Tableau de caractéristiques principal
| Empirical Formula |
|---|
| C₁₈₈H₂₉₂N₅₈O₆₅S₆ |
| References | |
|---|---|
| References | Shan L, et al. 2008. Biochem Biophys Res Commun. 375, 69. Da-Wei Zhang, et al. 2007. J. Biol. Chem. 282, 18602. |
| Product Information | |
|---|---|
| Form | White powder |
| Hill Formula | C₁₈₈H₂₉₂N₅₈O₆₅S₆ |
| Chemical formula | C₁₈₈H₂₉₂N₅₈O₆₅S₆ |
| Hygroscopic | Hygroscopic |
| Quality Level | MQ100 |
| Applications |
|---|
| Biological Information | |
|---|---|
| Primary Target | PCSK9 |
| Primary Target K<sub>i</sub> | 0.3 µ |
| Purity | ≥95% by HPLC |
| Physicochemical Information | |
|---|---|
| Peptide Sequence | GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2 (Disulfide Bridge: 5-16, 12-25, 27-39) |
| Dimensions |
|---|
| Materials Information |
|---|
| Toxicological Information |
|---|
| Safety Information according to GHS |
|---|
| Safety Information |
|---|
| Product Usage Statements |
|---|
| Packaging Information | |
|---|---|
| Packaged under inert gas | Packaged under inert gas |
| Transport Information |
|---|
| Supplemental Information |
|---|
| Specifications |
|---|
| Global Trade Item Number | |
|---|---|
| Référence | GTIN |
| 508761 | 0 |
Documentation
PCSK9 Inhibitor, EGF-A - Calbiochem FDS
| Titre |
|---|
Références bibliographiques
| Aperçu de la référence bibliographique |
|---|
| Shan L, et al. 2008. Biochem Biophys Res Commun. 375, 69. Da-Wei Zhang, et al. 2007. J. Biol. Chem. 282, 18602. |
Brochure
| Titre |
|---|
| NPI Flyer- Epigenetics and Nuclear Function Feature |
| New Products - Antibodies, Small Molecule, Inhibitors |
Informations techniques
| Titre |
|---|
| White Paper: Further considerations of antibody validation and usage. |


